PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_173815g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 95aa    MW: 10275.5 Da    PI: 8.2921
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_173815g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer96.81.7e-302781257
     ZF-HD_dimer  2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                    e+vrY+eC+kNhAas+Gg+avDGC Ef++s g+egtaaa+kCa C+CHR+FHRrev
  MA_173815g0010 27 EGVRYRECRKNHAASIGGYAVDGCAEFIAS-GDEGTAAAMKCASCNCHRSFHRREV 81
                    579**************************9.999********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-202491IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.4E-292981IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.2E-263081IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.3973180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 95 aa     Download sequence    Send to blast
MGPSKRVQQI EEGTAAIARE GDIVSREGVR YRECRKNHAA SIGGYAVDGC AEFIASGDEG  60
TAAAMKCASC NCHRSFHRRE VGNGTQCECR RIRGL
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1048641e-103BT104864.1 Picea glauca clone GQ02815_P23 mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792497.12e-32PREDICTED: mini zinc finger protein 1-like
SwissprotQ9LJW56e-25MIF2_ARATH; Mini zinc finger protein 2
SwissprotQ9SVL09e-25ZHD7_ARATH; Zinc-finger homeodomain protein 7
TrEMBLA9NK897e-52A9NK89_PICSI; Putative uncharacterized protein
STRINGVIT_08s0056g01130.t019e-27(Vitis vinifera)
STRINGSb08g001830.16e-27(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.14e-26mini zinc finger 2